No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00007454-M05 |
| Product name: | WAS monoclonal antibody (M05), clone 3H5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant WAS. |
| Clone: | 3H5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7454 |
| Gene name: | WAS |
| Gene alias: | IMD2|THC|WASP |
| Gene description: | Wiskott-Aldrich syndrome (eczema-thrombocytopenia) |
| Genbank accession: | NM_000377 |
| Immunogen: | WAS (NP_000368, 57 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LPPGAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEER |
| Protein accession: | NP_000368 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |