| Brand: | Abnova |
| Reference: | H00007450-M02 |
| Product name: | VWF monoclonal antibody (M02), clone 1A11 |
| Product description: | Mouse monoclonal antibody raised against partial propeptide of human VWF protein. |
| Clone: | 1A11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7450 |
| Gene name: | VWF |
| Gene alias: | F8VWF|VWD |
| Gene description: | von Willebrand factor |
| Genbank accession: | BC022258.1 |
| Immunogen: | VWF (AAH22258.1, 1 a.a. ~ 273 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGAQDEEEGIQDLDGLLVFDKIVEVTLLNLPWYNEETEGQRGEMTAPKSPRAKIRGTLCAEGTRGRSSTARCSLFGSDFVNTFDGSMYSFAGYCSYLLAGGCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDQRVSMPYASKGLYLETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTLTSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEMQKVGVDWPGCTWMVCDFWI |
| Protein accession: | AAH22258.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (55.77 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged VWF is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |