| Brand: | Abnova |
| Reference: | H00007429-M02 |
| Product name: | VIL1 monoclonal antibody (M02), clone 3G6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant VIL1. |
| Clone: | 3G6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7429 |
| Gene name: | VIL1 |
| Gene alias: | D2S1471|VIL |
| Gene description: | villin 1 |
| Genbank accession: | NM_007127 |
| Immunogen: | VIL1 (NP_009058, 1 a.a. ~ 77 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGA |
| Protein accession: | NP_009058 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged VIL1 is 0.1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |