| Brand: | Abnova |
| Reference: | H00007428-P01 |
| Product name: | VHL (Human) Recombinant Protein (P01) |
| Product description: | Human VHL full-length ORF ( ENSP00000344757, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 7428 |
| Gene name: | VHL |
| Gene alias: | HRCA1|RCA1|VHL1 |
| Gene description: | von Hippel-Lindau tumor suppressor |
| Genbank accession: | ENST00000345392 |
| Immunogen sequence/protein sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
| Protein accession: | ENSP00000344757 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | WSB1 promotes tumor metastasis by inducing pVHL degradation.Kim JJ, Lee SB, Jang J, Yi SY, Kim SH, Han SA, Lee JM, Tong SY, Vincelette ND, Gao B, Yin P, Evans D, Choi DW, Qin B, Liu T, Zhang H, Deng M, Jen J, Zhang J, Wang L, Lou Z. Genes Dev. 2015 Nov 1;29(21):2244-57. |