No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,WB-Tr |
Brand: | Abnova |
Reference: | H00007428-B01P |
Product name: | VHL purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human VHL protein. |
Gene id: | 7428 |
Gene name: | VHL |
Gene alias: | HRCA1|RCA1|VHL1 |
Gene description: | von Hippel-Lindau tumor suppressor |
Genbank accession: | NM_198156 |
Immunogen: | VHL (ENSP00000344757, 1 a.a. ~ 172 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD |
Protein accession: | ENSP00000344757 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of VHL expression in transfected 293T cell line (H00007428-T01) by VHL MaxPab polyclonal antibody. Lane 1: VHL transfected lysate(18.92 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,WB-Tr |
Shipping condition: | Dry Ice |