VHL MaxPab mouse polyclonal antibody (B01) View larger

VHL MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VHL MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about VHL MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00007428-B01
Product name: VHL MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human VHL protein.
Gene id: 7428
Gene name: VHL
Gene alias: HRCA1|RCA1|VHL1
Gene description: von Hippel-Lindau tumor suppressor
Genbank accession: NM_198156
Immunogen: VHL (NP_937799, 1 a.a. ~ 172 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIHSYRVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLERLTQERIAHQRMGD
Protein accession: NP_937799
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007428-B01-13-15-1.jpg
Application image note: Western Blot analysis of VHL expression in transfected 293T cell line (H00007428-T01) by VHL MaxPab polyclonal antibody.

Lane 1: VHL transfected lysate(18.92 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy VHL MaxPab mouse polyclonal antibody (B01) now

Add to cart