No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00007422-M05 |
Product name: | VEGF monoclonal antibody (M05), clone 3F7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VEGF. |
Clone: | 3F7 |
Isotype: | IgG2a Kappa |
Gene id: | 7422 |
Gene name: | VEGFA |
Gene alias: | MGC70609|VEGF|VEGF-A|VPF |
Gene description: | vascular endothelial growth factor A |
Genbank accession: | NM_003376 |
Immunogen: | VEGF (NP_003367, 27 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC |
Protein accession: | NP_003367 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged VEGF is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |
Publications: | Hypoxia-Selective Growth Inhibition of Cancer Cells by Furospinosulin-1, a Furanosesterterpene Isolated from an Indonesian Marine Sponge.Arai M, Kawachi T, Setiawan A, Kobayashi M. ChemMedChem. 2010 Sep 13. [Epub ahead of print] |