Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of VEGF monoclonal antibody (M05), clone 3F7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
More info about VEGF monoclonal antibody (M05), clone 3F7
| Brand: | Abnova |
| Reference: | H00007422-M05 |
| Product name: | VEGF monoclonal antibody (M05), clone 3F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant VEGF. |
| Clone: | 3F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7422 |
| Gene name: | VEGFA |
| Gene alias: | MGC70609|VEGF|VEGF-A|VPF |
| Gene description: | vascular endothelial growth factor A |
| Genbank accession: | NM_003376 |
| Immunogen: | VEGF (NP_003367, 27 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCEC |
| Protein accession: | NP_003367 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.18 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged VEGF is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,PLA-Ce |
| Shipping condition: | Dry Ice |
| Publications: | Hypoxia-Selective Growth Inhibition of Cancer Cells by Furospinosulin-1, a Furanosesterterpene Isolated from an Indonesian Marine Sponge.Arai M, Kawachi T, Setiawan A, Kobayashi M. ChemMedChem. 2010 Sep 13. [Epub ahead of print] |