Brand: | Abnova |
Reference: | H00007409-M03 |
Product name: | VAV1 monoclonal antibody (M03), clone 2C11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VAV1. |
Clone: | 2C11 |
Isotype: | IgG2a Kappa |
Gene id: | 7409 |
Gene name: | VAV1 |
Gene alias: | VAV |
Gene description: | vav 1 guanine nucleotide exchange factor |
Genbank accession: | BC013361 |
Immunogen: | VAV1 (AAH13361, 681 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC |
Protein accession: | AAH13361 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | VAV1 monoclonal antibody (M03), clone 2C11 Western Blot analysis of VAV1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |