VAV1 monoclonal antibody (M02), clone 1A6 View larger

VAV1 monoclonal antibody (M02), clone 1A6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VAV1 monoclonal antibody (M02), clone 1A6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about VAV1 monoclonal antibody (M02), clone 1A6

Brand: Abnova
Reference: H00007409-M02
Product name: VAV1 monoclonal antibody (M02), clone 1A6
Product description: Mouse monoclonal antibody raised against a partial recombinant VAV1.
Clone: 1A6
Isotype: IgG2a Kappa
Gene id: 7409
Gene name: VAV1
Gene alias: VAV
Gene description: vav 1 guanine nucleotide exchange factor
Genbank accession: BC013361
Immunogen: VAV1 (AAH13361, 681 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
Protein accession: AAH13361
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007409-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007409-M02-1-2-1.jpg
Application image note: VAV1 monoclonal antibody (M02), clone 1A6 Western Blot analysis of VAV1 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VAV1 monoclonal antibody (M02), clone 1A6 now

Add to cart