VAV1 monoclonal antibody (M01), clone 9C1 View larger

VAV1 monoclonal antibody (M01), clone 9C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of VAV1 monoclonal antibody (M01), clone 9C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,ELISA,WB-Re

More info about VAV1 monoclonal antibody (M01), clone 9C1

Brand: Abnova
Reference: H00007409-M01
Product name: VAV1 monoclonal antibody (M01), clone 9C1
Product description: Mouse monoclonal antibody raised against a partial recombinant VAV1.
Clone: 9C1
Isotype: IgG2b Kappa
Gene id: 7409
Gene name: VAV1
Gene alias: VAV
Gene description: vav 1 guanine nucleotide exchange factor
Genbank accession: BC013361
Immunogen: VAV1 (AAH13361, 681 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC
Protein accession: AAH13361
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007409-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007409-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to VAV1 on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy VAV1 monoclonal antibody (M01), clone 9C1 now

Add to cart