Brand: | Abnova |
Reference: | H00007409-M01 |
Product name: | VAV1 monoclonal antibody (M01), clone 9C1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VAV1. |
Clone: | 9C1 |
Isotype: | IgG2b Kappa |
Gene id: | 7409 |
Gene name: | VAV1 |
Gene alias: | VAV |
Gene description: | vav 1 guanine nucleotide exchange factor |
Genbank accession: | BC013361 |
Immunogen: | VAV1 (AAH13361, 681 a.a. ~ 790 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC |
Protein accession: | AAH13361 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to VAV1 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |