Brand: | Abnova |
Reference: | H00007392-M01 |
Product name: | USF2 monoclonal antibody (M01), clone 5E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USF2. |
Clone: | 5E9 |
Isotype: | IgG2a Kappa |
Gene id: | 7392 |
Gene name: | USF2 |
Gene alias: | FIP|bHLHb12 |
Gene description: | upstream transcription factor 2, c-fos interacting |
Genbank accession: | NM_003367 |
Immunogen: | USF2 (NP_003358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS |
Protein accession: | NP_003358 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |