USF2 monoclonal antibody (M01), clone 5E9 View larger

USF2 monoclonal antibody (M01), clone 5E9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of USF2 monoclonal antibody (M01), clone 5E9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about USF2 monoclonal antibody (M01), clone 5E9

Brand: Abnova
Reference: H00007392-M01
Product name: USF2 monoclonal antibody (M01), clone 5E9
Product description: Mouse monoclonal antibody raised against a partial recombinant USF2.
Clone: 5E9
Isotype: IgG2a Kappa
Gene id: 7392
Gene name: USF2
Gene alias: FIP|bHLHb12
Gene description: upstream transcription factor 2, c-fos interacting
Genbank accession: NM_003367
Immunogen: USF2 (NP_003358, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVS
Protein accession: NP_003358
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007392-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00007392-M01-3-51-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to USF2 on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 1 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy USF2 monoclonal antibody (M01), clone 5E9 now

Add to cart