Brand: | Abnova |
Reference: | H00007391-M02 |
Product name: | USF1 monoclonal antibody (M02), clone 2A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USF1. |
Clone: | 2A7 |
Isotype: | IgG1 kappa |
Gene id: | 7391 |
Gene name: | USF1 |
Gene alias: | FCHL|FCHL1|HYPLIP1|MLTF|MLTFI|UEF|bHLHb11 |
Gene description: | upstream transcription factor 1 |
Genbank accession: | NM_007122 |
Immunogen: | USF1 (NP_009053, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGT |
Protein accession: | NP_009053 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | USF1 monoclonal antibody (M02), clone 2A7 Western Blot analysis of USF1 expression in MCF-7 ( Cat # L046V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | A role of DNA-PK for the metabolic gene regulation in response to insulin.Wong RH, Chang I, Hudak CS, Hyun S, Kwan HY, Sul HS. Cell. 2009 Mar 20;136(6):1056-72. |