Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of USF1 monoclonal antibody (M02), clone 2A7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about USF1 monoclonal antibody (M02), clone 2A7
| Brand: | Abnova |
| Reference: | H00007391-M02 |
| Product name: | USF1 monoclonal antibody (M02), clone 2A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant USF1. |
| Clone: | 2A7 |
| Isotype: | IgG1 kappa |
| Gene id: | 7391 |
| Gene name: | USF1 |
| Gene alias: | FCHL|FCHL1|HYPLIP1|MLTF|MLTFI|UEF|bHLHb11 |
| Gene description: | upstream transcription factor 1 |
| Genbank accession: | NM_007122 |
| Immunogen: | USF1 (NP_009053, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGT |
| Protein accession: | NP_009053 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | USF1 monoclonal antibody (M02), clone 2A7 Western Blot analysis of USF1 expression in MCF-7 ( Cat # L046V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A role of DNA-PK for the metabolic gene regulation in response to insulin.Wong RH, Chang I, Hudak CS, Hyun S, Kwan HY, Sul HS. Cell. 2009 Mar 20;136(6):1056-72. |