Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of USF1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about USF1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007391-A01 |
| Product name: | USF1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant USF1. |
| Gene id: | 7391 |
| Gene name: | USF1 |
| Gene alias: | FCHL|FCHL1|HYPLIP1|MLTF|MLTFI|UEF|bHLHb11 |
| Gene description: | upstream transcription factor 1 |
| Genbank accession: | NM_007122 |
| Immunogen: | USF1 (NP_009053, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MKGQQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSDDAVDTEGT |
| Protein accession: | NP_009053 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Histone Crosstalk Directed by H2B Ubiquitination Is Required for Chromatin Boundary Integrity.Ma MK, Heath C, Hair A, West AG. PLoS Genet. 2011 Jul;7(7):e1002175. Epub 2011 Jul 21. |