Brand: | Abnova |
Reference: | H00007388-M02 |
Product name: | UQCRH monoclonal antibody (M02), clone 1D7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant UQCRH. |
Clone: | 1D7 |
Isotype: | IgG2a Kappa |
Gene id: | 7388 |
Gene name: | UQCRH |
Gene alias: | MGC111572|QCR6 |
Gene description: | ubiquinol-cytochrome c reductase hinge protein |
Genbank accession: | BC015177 |
Immunogen: | UQCRH (AAH15177, 1 a.a. ~ 91 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK |
Protein accession: | AAH15177 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UQCRH is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |