No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00007388-A01 |
Product name: | UQCRH polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a full-length recombinant UQCRH. |
Gene id: | 7388 |
Gene name: | UQCRH |
Gene alias: | MGC111572|QCR6 |
Gene description: | ubiquinol-cytochrome c reductase hinge protein |
Genbank accession: | BC015177 |
Immunogen: | UQCRH (AAH15177, 1 a.a. ~ 91 a.a) full-length recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSRSHTEEDCTEELFDFLHARDHCVAHKLFNNLK |
Protein accession: | AAH15177 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.12 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |