UQCRC2 purified MaxPab mouse polyclonal antibody (B01P) View larger

UQCRC2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UQCRC2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IF,WB-Tr

More info about UQCRC2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007385-B01P
Product name: UQCRC2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human UQCRC2 protein.
Gene id: 7385
Gene name: UQCRC2
Gene alias: QCR2|UQCR2
Gene description: ubiquinol-cytochrome c reductase core protein II
Genbank accession: NM_003366.2
Immunogen: UQCRC2 (NP_003357.2, 1 a.a. ~ 453 a.a) full-length human protein.
Immunogen sequence/protein sequence: MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSRIGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
Protein accession: NP_003357.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007385-B01P-13-15-1.jpg
Application image note: Western Blot analysis of UQCRC2 expression in transfected 293T cell line (H00007385-T01) by UQCRC2 MaxPab polyclonal antibody.

Lane 1: UQCRC2 transfected lysate(49.83 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UQCRC2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart