Brand: | Abnova |
Reference: | H00007375-M01 |
Product name: | USP4 monoclonal antibody (M01), clone 5E12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant USP4. |
Clone: | 5E12 |
Isotype: | IgG2a Kappa |
Gene id: | 7375 |
Gene name: | USP4 |
Gene alias: | MGC149848|MGC149849|UNP|Unph |
Gene description: | ubiquitin specific peptidase 4 (proto-oncogene) |
Genbank accession: | NM_003363 |
Immunogen: | USP4 (NP_003354, 676 a.a. ~ 773 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ETEGSGEDEPGNDPSETTQKKIKGQPCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQKKKK |
Protein accession: | NP_003354 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged USP4 is approximately 10ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |