COL14A1 monoclonal antibody (M01), clone 5F3 View larger

COL14A1 monoclonal antibody (M01), clone 5F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of COL14A1 monoclonal antibody (M01), clone 5F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about COL14A1 monoclonal antibody (M01), clone 5F3

Brand: Abnova
Reference: H00007373-M01
Product name: COL14A1 monoclonal antibody (M01), clone 5F3
Product description: Mouse monoclonal antibody raised against a partial recombinant COL14A1.
Clone: 5F3
Isotype: IgG1 Kappa
Gene id: 7373
Gene name: COL14A1
Gene alias: UND
Gene description: collagen, type XIV, alpha 1
Genbank accession: NM_021110
Immunogen: COL14A1 (NP_066933, 34 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TRLRYNVISHDSIQISWKAPRGKFGGYKLLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDL
Protein accession: NP_066933
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007373-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.31 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007373-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged COL14A1 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy COL14A1 monoclonal antibody (M01), clone 5F3 now

Add to cart