| Brand: | Abnova |
| Reference: | H00007372-M06 |
| Product name: | UMPS monoclonal antibody (M06), clone 2B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UMPS. |
| Clone: | 2B10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7372 |
| Gene name: | UMPS |
| Gene alias: | OPRT |
| Gene description: | uridine monophosphate synthetase |
| Genbank accession: | NM_000373 |
| Immunogen: | UMPS (NP_000364, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG |
| Protein accession: | NP_000364 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | UMPS monoclonal antibody (M06), clone 2B10. Western Blot analysis of UMPS expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Novel mRNA isoforms and mutations of uridine monophosphate synthetase and 5-fluorouracil resistance in colorectal cancer.Griffith M, Mwenifumbo JC, Cheung PY, Paul JE, Pugh TJ, Tang MJ, Chittaranjan S, Morin RD, Asano JK, Ally AA, Miao L, Lee A, Chan SY, Taylor G, Severson T, Hou YC, Griffith OL, Cheng GS, Novik K, Moore R, Luk M, Owen D, Brown CJ, Morin GB, Gill S, Tai IT, Marra MA. Pharmacogenomics J. 2012 Jan 17. doi: 10.1038/tpj.2011.65. [Epub ahead of print] |