| Brand:  | Abnova | 
| Reference:  | H00007371-M03 | 
| Product name:  | UCK2 monoclonal antibody (M03), clone 1G12 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant UCK2. | 
| Clone:  | 1G12 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 7371 | 
| Gene name:  | UCK2 | 
| Gene alias:  | TSA903|UK|UMPK | 
| Gene description:  | uridine-cytidine kinase 2 | 
| Genbank accession:  | BC002906 | 
| Immunogen:  | UCK2 (AAH02906, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTPKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKR*ASESSSRPH | 
| Protein accession:  | AAH02906 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoprecipitation of UCK2 transfected lysate using anti-UCK2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with UCK2 MaxPab rabbit polyclonal antibody. | 
| Applications:  | S-ELISA,ELISA,IP | 
| Shipping condition:  | Dry Ice |