UCK2 purified MaxPab mouse polyclonal antibody (B01P) View larger

UCK2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UCK2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about UCK2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007371-B01P
Product name: UCK2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human UCK2 protein.
Gene id: 7371
Gene name: UCK2
Gene alias: TSA903|UK|UMPK
Gene description: uridine-cytidine kinase 2
Genbank accession: NM_012474.3
Immunogen: UCK2 (NP_036606.2, 1 a.a. ~ 261 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAGDSEQTLQNHQQPNGGEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRQKQVVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKEITEGKTVQIPVYDFVSHSRKEETVTVYPADVVLFEGILAFYSQEVRDLFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITFVKPAFEEFCLPTKKYADVIIPRGADNLVAINLIVQHIQDILNGGPSKRQTNGCLNGYTPSRKRQASESSSRPH
Protein accession: NP_036606.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007371-B01P-13-15-1.jpg
Application image note: Western Blot analysis of UCK2 expression in transfected 293T cell line (H00007371-T01) by UCK2 MaxPab polyclonal antibody.

Lane 1: UCK2 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UCK2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart