| Brand: | Abnova |
| Reference: | H00007369-M03 |
| Product name: | UMOD monoclonal antibody (M03), clone 3F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UMOD. |
| Clone: | 3F10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7369 |
| Gene name: | UMOD |
| Gene alias: | ADMCKD2|FJHN|HNFJ|MCKD2|THGP|THP |
| Gene description: | uromodulin |
| Genbank accession: | NM_001008389 |
| Immunogen: | UMOD (NP_001008390.1, 25 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSANSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHC |
| Protein accession: | NP_001008390.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.3 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged UMOD is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Mass spectrometric study of stone matrix proteins of human bladder stones.Jou YC, Tsai YS, Fang CY, Chen SY, Chen FH, Huang CH, Li YH, Shen CH Urology. 2013 Aug;82(2):295-300. doi: 10.1016/j.urology.2013.04.011. |