| Brand: | Abnova |
| Reference: | H00007368-A01 |
| Product name: | UGT8 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant UGT8. |
| Gene id: | 7368 |
| Gene name: | UGT8 |
| Gene alias: | CGT |
| Gene description: | UDP glycosyltransferase 8 |
| Genbank accession: | NM_003360 |
| Immunogen: | UGT8 (NP_003351, 31 a.a. ~ 140 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FESHMYIFKTLASALHERGHHTVFLLSEGRDIAPSNHYSLQRYPGIFNSTTSDAFLQSKMRNIFSGRLTAIELFDILDHYTKNCDLMVGNHALIQGLKKEKFDLLLVDPN |
| Protein accession: | NP_003351 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Acute kidney injury induced by protein-overload nephropathy down-regulates gene expression of hepatic cerebroside sulfotransferase in mice, resulting in reduction of liver and serum sulfatides.Zhang X, Nakajima T, Kamijo Y, Li G, Hu R, Kannagi R, Kyogashima M, Aoyama T, Hara A. Biochem Biophys Res Commun. 2009 Nov 4. [Epub ahead of print] |