UGT2B15 purified MaxPab mouse polyclonal antibody (B01P) View larger

UGT2B15 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UGT2B15 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about UGT2B15 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007366-B01P
Product name: UGT2B15 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human UGT2B15 protein.
Gene id: 7366
Gene name: UGT2B15
Gene alias: UGT2B8
Gene description: UDP glucuronosyltransferase 2 family, polypeptide B15
Genbank accession: BC146570
Immunogen: UGT2B15 (AAI46571.1, 1 a.a. ~ 530 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD
Protein accession: AAI46571.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007366-B01P-13-15-1.jpg
Application image note: Western Blot analysis of UGT2B15 expression in transfected 293T cell line (H00007366-T01) by UGT2B15 MaxPab polyclonal antibody.

Lane 1: UGT2B15 transfected lysate(58.3 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UGT2B15 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart