| Brand:  | Abnova | 
| Reference:  | H00007364-M02 | 
| Product name:  | UGT2B7 monoclonal antibody (M02), clone 8D12 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant UGT2B7. | 
| Clone:  | 8D12 | 
| Isotype:  | IgG2b Kappa | 
| Gene id:  | 7364 | 
| Gene name:  | UGT2B7 | 
| Gene alias:  | UGT2B9 | 
| Gene description:  | UDP glucuronosyltransferase 2 family, polypeptide B7 | 
| Genbank accession:  | NM_001074 | 
| Immunogen:  | UGT2B7 (NP_001065, 69 a.a. ~ 157 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | SSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCS | 
| Protein accession:  | NP_001065 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (35.53 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Rat | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged UGT2B7 is 0.1 ng/ml as a capture antibody. | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice |