| Brand:  | Abnova | 
| Reference:  | H00007360-M01 | 
| Product name:  | UGP2 monoclonal antibody (M01), clone 3H3 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant UGP2. | 
| Clone:  | 3H3 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 7360 | 
| Gene name:  | UGP2 | 
| Gene alias:  | UDPG|UDPGP2|UGPP2|pHC379 | 
| Gene description:  | UDP-glucose pyrophosphorylase 2 | 
| Genbank accession:  | NM_001001521 | 
| Immunogen:  | UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI | 
| Protein accession:  | NP_001001521 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (35.64 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse,Rat | 
| Application image:  |   | 
| Application image note:  | UGP2 monoclonal antibody (M01), clone 3H3 Western Blot analysis of UGP2 expression in HeLa ( Cat # L013V1 ). | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab | 
| Shipping condition:  | Dry Ice |