UGP2 purified MaxPab mouse polyclonal antibody (B01P) View larger

UGP2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UGP2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about UGP2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00007360-B01P
Product name: UGP2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human UGP2 protein.
Gene id: 7360
Gene name: UGP2
Gene alias: UDPG|UDPGP2|UGPP2|pHC379
Gene description: UDP-glucose pyrophosphorylase 2
Genbank accession: NM_006759.3
Immunogen: UGP2 (NP_006750.3, 1 a.a. ~ 508 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSRFVQDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH
Protein accession: NP_006750.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007360-B01P-13-15-1.jpg
Application image note: Western Blot analysis of UGP2 expression in transfected 293T cell line (H00007360-T01) by UGP2 MaxPab polyclonal antibody.

Lane 1: UGP2 transfected lysate(56.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy UGP2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart