UGP2 polyclonal antibody (A01) View larger

UGP2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UGP2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about UGP2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00007360-A01
Product name: UGP2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant UGP2.
Gene id: 7360
Gene name: UGP2
Gene alias: UDPG|UDPGP2|UGPP2|pHC379
Gene description: UDP-glucose pyrophosphorylase 2
Genbank accession: NM_001001521
Immunogen: UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
Protein accession: NP_001001521
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007360-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007360-A01-1-12-1.jpg
Application image note: UGP2 polyclonal antibody (A01), Lot # 060707JCS1 Western Blot analysis of UGP2 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UGP2 polyclonal antibody (A01) now

Add to cart