Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UGCG monoclonal antibody (M03), clone 1E5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about UGCG monoclonal antibody (M03), clone 1E5
| Brand: | Abnova |
| Reference: | H00007357-M03 |
| Product name: | UGCG monoclonal antibody (M03), clone 1E5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UGCG. |
| Clone: | 1E5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7357 |
| Gene name: | UGCG |
| Gene alias: | GCS |
| Gene description: | UDP-glucose ceramide glucosyltransferase |
| Genbank accession: | NM_003358 |
| Immunogen: | UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG |
| Protein accession: | NP_003349 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | DNA damage induces down-regulation of UDP-glucose ceramide glucosyltransferase, increases ceramide levels and triggers apoptosis in p53-deficient cancer cells.Haynes TA, Filippov V, Filippova M, Yang J, Zhang K, Duerksen-Hughes PJ. Biochim Biophys Acta. 2012 Feb 11. [Epub ahead of print] |