| Brand:  | Abnova | 
| Reference:  | H00007357-M03 | 
| Product name:  | UGCG monoclonal antibody (M03), clone 1E5 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant UGCG. | 
| Clone:  | 1E5 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 7357 | 
| Gene name:  | UGCG | 
| Gene alias:  | GCS | 
| Gene description:  | UDP-glucose ceramide glucosyltransferase | 
| Genbank accession:  | NM_003358 | 
| Immunogen:  | UGCG (NP_003349, 33 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | TRLHLNKKATDKQPYSKLPGVSLLKPLKGVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIDVCKKLLGKYPNVDARLFIGGKKVGINPKINNLMPG | 
| Protein accession:  | NP_003349 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.63 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged UGCG is 0.3 ng/ml as a capture antibody. | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice | 
| Publications:  | DNA damage induces down-regulation of UDP-glucose ceramide glucosyltransferase, increases ceramide levels and triggers apoptosis in p53-deficient cancer cells.Haynes TA, Filippov V, Filippova M, Yang J, Zhang K, Duerksen-Hughes PJ. Biochim Biophys Acta. 2012 Feb 11. [Epub ahead of print] |