Brand: | Abnova |
Reference: | H00007350-M03A |
Product name: | UCP1 monoclonal antibody (M03A), clone 4B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UCP1. |
Clone: | 4B7 |
Isotype: | IgG2a Kappa |
Gene id: | 7350 |
Gene name: | UCP1 |
Gene alias: | SLC25A7|UCP |
Gene description: | uncoupling protein 1 (mitochondrial, proton carrier) |
Genbank accession: | NM_021833 |
Immunogen: | UCP1 (NP_068605, 232 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF |
Protein accession: | NP_068605 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (29.7 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | UCP1 monoclonal antibody (M03A), clone 4B7. Western Blot analysis of UCP1 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |