| Brand: | Abnova |
| Reference: | H00007350-M03 |
| Product name: | UCP1 monoclonal antibody (M03), clone 4B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UCP1. |
| Clone: | 4B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7350 |
| Gene name: | UCP1 |
| Gene alias: | SLC25A7|UCP |
| Gene description: | uncoupling protein 1 (mitochondrial, proton carrier) |
| Genbank accession: | NM_021833 |
| Immunogen: | UCP1 (NP_068605, 232 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF |
| Protein accession: | NP_068605 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (29.7 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | UCP1 monoclonal antibody (M03), clone 4B7. Western Blot analysis of UCP1 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |