UPK1B monoclonal antibody (M05), clone 4F4 View larger

UPK1B monoclonal antibody (M05), clone 4F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UPK1B monoclonal antibody (M05), clone 4F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about UPK1B monoclonal antibody (M05), clone 4F4

Brand: Abnova
Reference: H00007348-M05
Product name: UPK1B monoclonal antibody (M05), clone 4F4
Product description: Mouse monoclonal antibody raised against a partial recombinant UPK1B.
Clone: 4F4
Isotype: IgG2a Kappa
Gene id: 7348
Gene name: UPK1B
Gene alias: TSPAN20|UPIB|UPK1
Gene description: uroplakin 1B
Genbank accession: NM_006952
Immunogen: UPK1B (NP_008883, 131 a.a. ~ 228 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNR
Protein accession: NP_008883
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007348-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007348-M05-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged UPK1B is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UPK1B monoclonal antibody (M05), clone 4F4 now

Add to cart