Brand: | Abnova |
Reference: | H00007347-M01 |
Product name: | UCHL3 monoclonal antibody (M01), clone 4E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UCHL3. |
Clone: | 4E9 |
Isotype: | IgG2a Kappa |
Gene id: | 7347 |
Gene name: | UCHL3 |
Gene alias: | UCH-L3 |
Gene description: | ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) |
Genbank accession: | NM_006002 |
Immunogen: | UCHL3 (NP_005993, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA |
Protein accession: | NP_005993 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: |  |
Application image note: | UCHL3 monoclonal antibody (M01), clone 4E9 Western Blot analysis of UCHL3 expression in K-562 ( Cat # L009V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Proteomic analysis of the effects of the immunomodulatory mycotoxin deoxynivalenol.da Costa AN, Mijal RS, Keen JN, Findlay JB, Wild CP. Proteomics. 2011 Mar 9. doi: 10.1002/pmic.201000580. [Epub ahead of print] |