| Brand:  | Abnova | 
| Reference:  | H00007343-M05 | 
| Product name:  | UBTF monoclonal antibody (M05), clone 2C6 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant UBTF. | 
| Clone:  | 2C6 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 7343 | 
| Gene name:  | UBTF | 
| Gene alias:  | NOR-90|UBF | 
| Gene description:  | upstream binding transcription factor, RNA polymerase I | 
| Genbank accession:  | NM_014233 | 
| Immunogen:  | UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS | 
| Protein accession:  | NP_055048 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.74 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Rat | 
| Application image:  |   | 
| Application image note:  | UBTF monoclonal antibody (M05), clone 2C6 Western Blot analysis of UBTF expression in HepG2 ( Cat # L019V1 ). | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |