UBTF monoclonal antibody (M05), clone 2C6 View larger

UBTF monoclonal antibody (M05), clone 2C6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UBTF monoclonal antibody (M05), clone 2C6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about UBTF monoclonal antibody (M05), clone 2C6

Brand: Abnova
Reference: H00007343-M05
Product name: UBTF monoclonal antibody (M05), clone 2C6
Product description: Mouse monoclonal antibody raised against a partial recombinant UBTF.
Clone: 2C6
Isotype: IgG1 Kappa
Gene id: 7343
Gene name: UBTF
Gene alias: NOR-90|UBF
Gene description: upstream binding transcription factor, RNA polymerase I
Genbank accession: NM_014233
Immunogen: UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
Protein accession: NP_055048
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007343-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Rat
Application image: H00007343-M05-1-12-1.jpg
Application image note: UBTF monoclonal antibody (M05), clone 2C6 Western Blot analysis of UBTF expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy UBTF monoclonal antibody (M05), clone 2C6 now

Add to cart