Brand: | Abnova |
Reference: | H00007343-M01 |
Product name: | UBTF monoclonal antibody (M01), clone 6B6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBTF. |
Clone: | 6B6 |
Isotype: | IgG2a Kappa |
Gene id: | 7343 |
Gene name: | UBTF |
Gene alias: | NOR-90|UBF |
Gene description: | upstream binding transcription factor, RNA polymerase I |
Genbank accession: | NM_014233 |
Immunogen: | UBTF (NP_055048, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS |
Protein accession: | NP_055048 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to UBTF on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Nuclear and Nucleolar Reprogramming during the First Cell Cycle in Bovine Nuclear Transfer Embryos.Ostrup O, Petrovicova I, Strejcek F, Morovic M, Lucas-Hahn A, Lemme E, Petersen B, Niemann H, Laurincik J, Maddox-Hyttel P. Cloning Stem Cells. 2009 Sep;11(3):367-75. |