Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SUMO1 monoclonal antibody (M03), clone 3D7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about SUMO1 monoclonal antibody (M03), clone 3D7
| Brand: | Abnova |
| Reference: | H00007341-M03 |
| Product name: | SUMO1 monoclonal antibody (M03), clone 3D7 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SUMO1. |
| Clone: | 3D7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7341 |
| Gene name: | SUMO1 |
| Gene alias: | DAP-1|GMP1|OFC10|PIC1|SENP2|SMT3|SMT3C|SMT3H3|SUMO-1|UBL1 |
| Gene description: | SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) |
| Genbank accession: | NM_001005781.1 |
| Immunogen: | SUMO1 (NP_001005781.1, 1 a.a. ~ 101 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| Protein accession: | NP_001005781.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SUMO1 expression in transfected 293T cell line by SUMO1 monoclonal antibody (M03), clone 3D7. Lane 1: SUMO1 transfected lysate (Predicted MW: 11.6 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |