Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SUMO1 MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about SUMO1 MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00007341-B01 |
| Product name: | SUMO1 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human SUMO1 protein. |
| Gene id: | 7341 |
| Gene name: | SUMO1 |
| Gene alias: | DAP-1|GMP1|OFC10|PIC1|SENP2|SMT3|SMT3C|SMT3H3|SUMO-1|UBL1 |
| Gene description: | SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) |
| Genbank accession: | NM_001005781.1 |
| Immunogen: | SUMO1 (NP_001005781.1, 1 a.a. ~ 101 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV |
| Protein accession: | NP_001005781.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of SUMO1 expression in transfected 293T cell line (H00007341-T02) by SUMO1 MaxPab polyclonal antibody. Lane 1: SUMO1 transfected lysate(11.60 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Identification of unique sensitizing targets for anti-inflammatory CDDO-Me in metastatic melanoma by a large-scale synthetic lethal RNAi screening.Qin Y, Deng W, Ekmekcioglu S, Grimm EA. Pigment Cell Melanoma Res. 2012 Oct 1. doi: 10.1111/pcmr.12031. |