Cart 22 Product Products 7 720,40 € (empty)
No products
To be determined Shipping
7 720,40 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 22 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 7 720,40 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 7 720,40 €
Data sheet of UBE2N monoclonal antibody (M02), clone 3G1-D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about UBE2N monoclonal antibody (M02), clone 3G1-D10
| Brand: | Abnova |
| Reference: | H00007334-M02 |
| Product name: | UBE2N monoclonal antibody (M02), clone 3G1-D10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant UBE2N. |
| Clone: | 3G1-D10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 7334 |
| Gene name: | UBE2N |
| Gene alias: | MGC131857|MGC8489|UBC13|UbcH-ben |
| Gene description: | ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) |
| Genbank accession: | BC003365 |
| Immunogen: | UBE2N (AAH03365, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMNNI |
| Protein accession: | AAH03365 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.46 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | UBE2N monoclonal antibody (M02), clone 3G1-D10 Western Blot analysis of UBE2N expression in LNCaP ( Cat # L004V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |