| Brand: | Abnova |
| Reference: | H00007323-M03 |
| Product name: | UBE2D3 monoclonal antibody (M03), clone S2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant UBE2D3. |
| Clone: | S2 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7323 |
| Gene name: | UBE2D3 |
| Gene alias: | E2(17)KB3|MGC43926|MGC5416|UBC4/5|UBCH5C |
| Gene description: | ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast) |
| Genbank accession: | BC003395 |
| Immunogen: | UBE2D3 (AAH03395, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM |
| Protein accession: | AAH03395 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.91 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |