| Brand: | Abnova |
| Reference: | H00007322-M02 |
| Product name: | UBE2D2 monoclonal antibody (M02), clone 4A1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2D2. |
| Clone: | 4A1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7322 |
| Gene name: | UBE2D2 |
| Gene alias: | E2(17)KB2|PUBC1|UBC4|UBC4/5|UBCH5B |
| Gene description: | ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) |
| Genbank accession: | NM_003339 |
| Immunogen: | UBE2D2 (NP_003330, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWS |
| Protein accession: | NP_003330 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | UBE2D2 monoclonal antibody (M02), clone 4A1 Western Blot analysis of UBE2D2 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | A 4-gene signature predicts survival of patients with resected adenocarcinoma of the esophagus, junction, and gastric cardia.Peters CJ, Rees JR, Hardwick RH, Hardwick JS, Vowler SL, Ong CA, Zhang C, Save V, O'Donovan M, Rassl D, Alderson D, Caldas C, Fitzgerald RC, OCCAMS Study Group. Gastroenterology (2009), doi: 10.1053/ j.gastro.2010.05.080. |