Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UBE2D1 monoclonal antibody (M01), clone 2C6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about UBE2D1 monoclonal antibody (M01), clone 2C6
| Brand: | Abnova |
| Reference: | H00007321-M01 |
| Product name: | UBE2D1 monoclonal antibody (M01), clone 2C6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2D1. |
| Clone: | 2C6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 7321 |
| Gene name: | UBE2D1 |
| Gene alias: | E2(17)KB1|SFT|UBC4/5|UBCH5|UBCH5A |
| Gene description: | ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) |
| Genbank accession: | NM_003338 |
| Immunogen: | UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS |
| Protein accession: | NP_003329 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.08 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to UBE2D1 on formalin-fixed paraffin-embedded human cervix cancer. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | The stability of HSV-1 ICP0 early after infection is defined by the RING finger and the UL13 protein kinase.Zhu Z, Du T, Zhou G, Roizman B J Virol. 2014 Feb 26. |