Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of UBE2D1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about UBE2D1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00007321-A01 |
| Product name: | UBE2D1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant UBE2D1. |
| Gene id: | 7321 |
| Gene name: | UBE2D1 |
| Gene alias: | E2(17)KB1|SFT|UBC4/5|UBCH5|UBCH5A |
| Gene description: | ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) |
| Genbank accession: | NM_003338 |
| Immunogen: | UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS |
| Protein accession: | NP_003329 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.45 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Exposure to cigarette smoke induces overexpression of von Hippel-Lindau tumor suppressor in mouse skeletal muscle.Basic VT, Tadele E, Elmabsout AA, Yao H, Rahman I, Sirsjo A, Abdel-Halim SM. Am J Physiol Lung Cell Mol Physiol. 2012 Sep;303(6):L519-27. Epub 2012 Jul 27. |