| Brand: | Abnova |
| Reference: | H00007317-Q01 |
| Product name: | UBE1 (Human) Recombinant Protein (Q01) |
| Product description: | Human UBE1 partial ORF ( NP_003325, 751 a.a. - 850 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 7317 |
| Gene name: | UBA1 |
| Gene alias: | A1S9|A1S9T|A1ST|AMCX1|GXP1|MGC4781|SMAX2|UBA1A|UBE1|UBE1X |
| Gene description: | ubiquitin-like modifier activating enzyme 1 |
| Genbank accession: | NM_003334 |
| Immunogen sequence/protein sequence: | PLTFDVNNPLHLDYVMAAANLFAQTYGLTGSQDRAAVATFLQSVQVPEFTPKSGVKIHVSDQELQSANASVDDSRLEELKATLPSPDKLPGFKMYPIDFE |
| Protein accession: | NP_003325 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |