| Brand:  | Abnova | 
| Reference:  | H00007301-M05 | 
| Product name:  | TYRO3 monoclonal antibody (M05), clone 4F6 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant TYRO3. | 
| Clone:  | 4F6 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 7301 | 
| Gene name:  | TYRO3 | 
| Gene alias:  | BYK|Brt|Dtk|FLJ16467|RSE|Sky|Tif | 
| Gene description:  | TYRO3 protein tyrosine kinase | 
| Genbank accession:  | BC049368 | 
| Immunogen:  | TYRO3 (AAH49368, 50 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | VKLTVSQGQPVRLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEISQPVWLTVEGVPFFTVEPKDLAV | 
| Protein accession:  | AAH49368 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (36.52 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Western blot analysis of TYRO3 over-expressed 293 cell line, cotransfected with TYRO3 Validated Chimera RNAi ( Cat # H00007301-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TYRO3 monoclonal antibody (M05) clone 4F6 (Cat # H00007301-M05 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. | 
| Applications:  | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab | 
| Shipping condition:  | Dry Ice |