| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr,IP |
| Brand: | Abnova |
| Reference: | H00007298-D01 |
| Product name: | TYMS MaxPab rabbit polyclonal antibody (D01) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TYMS protein. |
| Gene id: | 7298 |
| Gene name: | TYMS |
| Gene alias: | HsT422|MGC88736|TMS|TS|TSase |
| Gene description: | thymidylate synthetase |
| Genbank accession: | NM_001071.1 |
| Immunogen: | TYMS (AAH13919.1, 1 a.a. ~ 313 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV |
| Protein accession: | AAH13919.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of TYMS expression in transfected 293T cell line (H00007298-T02) by TYMS MaxPab polyclonal antibody. Lane 1: TYMS transfected lysate(35.70 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr,IP |
| Shipping condition: | Dry Ice |