| Brand:  | Abnova | 
| Reference:  | H00007295-M01 | 
| Product name:  | TXN monoclonal antibody (M01), clone 2A7 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant TXN. | 
| Clone:  | 2A7 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 7295 | 
| Gene name:  | TXN | 
| Gene alias:  | DKFZp686B1993|MGC61975|TRX|TRX1 | 
| Gene description:  | thioredoxin | 
| Genbank accession:  | BC003377 | 
| Immunogen:  | TXN (AAH03377, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV | 
| Protein accession:  | AAH03377 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.29 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunofluorescence of monoclonal antibody to TXN on HeLa cell. [antibody concentration 10 ug/ml] | 
| Applications:  | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Response of esophageal cancer cells to epigenetic inhibitors is mediated via altered thioredoxin activity.Ahrens TD, Timme S, Ostendorp J, Bogatyreva L, Hoeppner J, Hopt UT, Hauschke D, Werner M, Lassmann S. Lab Invest. 2015 Dec 21. [Epub ahead of print] |