Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TWIST1 monoclonal antibody (M01), clone 3E11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
More info about TWIST1 monoclonal antibody (M01), clone 3E11
| Brand: | Abnova |
| Reference: | H00007291-M01 |
| Product name: | TWIST1 monoclonal antibody (M01), clone 3E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TWIST1. |
| Clone: | 3E11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 7291 |
| Gene name: | TWIST1 |
| Gene alias: | ACS3|BPES2|BPES3|SCS|TWIST|bHLHa38 |
| Gene description: | twist homolog 1 (Drosophila) |
| Genbank accession: | NM_000474 |
| Immunogen: | TWIST1 (NP_000465, 100 a.a. ~ 202 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PQSYEELQTQRVMANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAHERLSYAFSVWRMEGAWSMSASH |
| Protein accession: | NP_000465 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western Blot analysis of TWIST1 expression in transfected 293T cell line by TWIST1 monoclonal antibody (M01), clone 3E11. Lane 1: TWIST1 transfected lysate(21 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re,WB-Tr,IP,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Cellular migration and invasion uncoupled: Increased migration is not an inexorable consequence of EMT.Schaeffer D, Somarelli JA, Hanna G, Palmer GM, Garcia-Blanco MA Mol Cell Biol. 2014 Jul 7. pii: MCB.00694-14. |