TUBB2A monoclonal antibody (M05), clone 3F9 View larger

TUBB2A monoclonal antibody (M05), clone 3F9

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TUBB2A monoclonal antibody (M05), clone 3F9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,ELISA,WB-Re

More info about TUBB2A monoclonal antibody (M05), clone 3F9

Brand: Abnova
Reference: H00007280-M05
Product name: TUBB2A monoclonal antibody (M05), clone 3F9
Product description: Mouse monoclonal antibody raised against a full-length recombinant TUBB2A.
Clone: 3F9
Isotype: IgG2a Kappa
Gene id: 7280
Gene name: TUBB2A
Gene alias: TUBB|TUBB2|dJ40E16.7
Gene description: tubulin, beta 2A
Genbank accession: BC001194
Immunogen: TUBB2A (AAH01194, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA
Protein accession: AAH01194
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00007280-M05-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (74.47 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00007280-M05-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to TUBB2A on HeLa cell . [antibody concentration 10 ug/ml]
Applications: WB-Ce,IHC-P,IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy TUBB2A monoclonal antibody (M05), clone 3F9 now

Add to cart