Brand: | Abnova |
Reference: | H00007280-M03 |
Product name: | TUBB2A monoclonal antibody (M03), clone 2B2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant TUBB2A. |
Clone: | 2B2 |
Isotype: | IgG2a Kappa |
Gene id: | 7280 |
Gene name: | TUBB2A |
Gene alias: | TUBB|TUBB2|dJ40E16.7 |
Gene description: | tubulin, beta 2A |
Genbank accession: | BC001194 |
Immunogen: | TUBB2A (AAH01194, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA |
Protein accession: | AAH01194 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (74.47 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | TUBB2A monoclonal antibody (M03), clone 2B2. Western Blot analysis of TUBB2A expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,IHC-P,IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |