| Brand:  | Abnova | 
| Reference:  | H00007280-M02 | 
| Product name:  | TUBB2A monoclonal antibody (M02), clone 3C12 | 
| Product description:  | Mouse monoclonal antibody raised against a full-length recombinant TUBB2A. | 
| Clone:  | 3C12 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 7280 | 
| Gene name:  | TUBB2A | 
| Gene alias:  | TUBB|TUBB2|dJ40E16.7 | 
| Gene description:  | tubulin, beta 2A | 
| Genbank accession:  | BC001194 | 
| Immunogen:  | TUBB2A (AAH01194, 1 a.a. ~ 445 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNTNDLVSEYQQYQDATADEQGEFEEEEGEDEA | 
| Protein accession:  | AAH01194 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (74.47 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human,Mouse,Rat | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to TUBB2A on formalin-fixed paraffin-embedded human colon. [antibody concentration 6 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |